PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0060s0284.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 349aa    MW: 37760.4 Da    PI: 6.9672
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0060s0284.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18257290134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          C++C  tkTp+WR gp g+ktLCnaCG++y++ +
  Kaladp0060s0284.2.p 257 CQHCEITKTPQWRAGPLGPKTLCNACGVRYKSGR 290
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.1E-756342IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.279251287IPR000679Zinc finger, GATA-type
SMARTSM004017.2E-16251301IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-14255314No hitNo description
Gene3DG3DSA:3.30.50.101.2E-14255288IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.99E-15256313No hitNo description
PROSITE patternPS003440257282IPR000679Zinc finger, GATA-type
PfamPF003203.1E-16257290IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MAGGGPSFAD DFDCGNFFDQ IDDLLDFPDE SCNNNGESGL LCEDFKDFPS IWTQPDTFPG  60
SESVFSGSNS HSASDLSAEL SVPYEDIAEL EWLSTFVEDS FSAGNSLTID VTNSVPSKVV  120
SPSANQFRTS SPVSVLESSS SSYAGGKVMP VKPALPIGGR CGRARSKRPR PSTFSPRPSM  180
QLISPTASFT RPATLFDVGK TGCAEFESFN DTGYSLKMSE SAGKMEHKKK KKMKLSADVN  240
QNKNPNPLSP EVAVRKCQHC EITKTPQWRA GPLGPKTLCN ACGVRYKSGR LFPEYRPAAS  300
PTFVPSVHSN SHKKVLEMRV KACDRTPLVG DSSKIELIPN KNPLVDYM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166170KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316371.21e-111zinc finger family protein
RefseqXP_006378769.11e-111hypothetical protein POPTR_0010s23010g
TrEMBLB9HUF81e-111B9HUF8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s23010.11e-110(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.25e-42GATA family protein